PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_020897-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family ZF-HD
Protein Properties Length: 223aa    MW: 25167.4 Da    PI: 8.6975
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_020897-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer85.17.5e-273791560
    ZF-HD_dimer  5 rYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                   +Y+e lkNhA+s+ gh++DGCg+fm++  eegt ++lkCa C CHRnFHR+e+e e
  NNU_020897-RA 37 KYREWLKNHAVSIRGHVIDGCGDFMAA-REEGTLDTLKCATCKCHRNFHRKETEGE 91
                   8*************************9.8889********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257747.0E-193789IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.6E-243787IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.3E-243788IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152321.9363887IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MRMLVLASYE SLGNLSRDKV AGTGGDGASF GKNTINKYRE WLKNHAVSIR GHVIDGCGDF  60
MAAREEGTLD TLKCATCKCH RNFHRKETEG EVYHHQFSPY YRTPMGYLHV ALYHRPLALP  120
LTSGGGGGAQ SREDQEDVSN PVDPLEPSKF KHKRVPKGYT IPLDKPQTLK HSIRRGGEIK  180
QSINTRTTLL CSELVYQDHD PRPMNRFRSN EEVVVILNEN NMD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010272957.14e-71PREDICTED: zinc-finger homeodomain protein 1-like
TrEMBLF6H1068e-59F6H106_VITVI; Putative uncharacterized protein
TrEMBLA5BZD72e-58A5BZD7_VITVI; Putative uncharacterized protein
STRINGVIT_18s0001g07140.t012e-58(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.12e-26homeobox protein 22